Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C ATP synthase subunit c (atpE)

This Recombinant Salmonella paratyphi C ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C0Q2N7

Expression Region

1-79

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Luciferin, FREE ACID
#10100-1 1x 50 mg

D-Luciferin, FREE ACID

Sign In for Pricing
View Details
TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: OTI10F8]
CF808440 100 µg

TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: OTI10F8]

Sign In for Pricing
View Details
Transcription factor 25 (TCF25) (NM_014972) Human Recombinant Protein
TP304078L 1 mg

Transcription factor 25 (TCF25) (NM_014972) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant TP53BP2 Antibody
RC-15230-01 50 μL

Recombinant TP53BP2 Antibody

Sign In for Pricing
View Details
Recombinant TP53BP2 Antibody
RC-15230-02 100 µL

Recombinant TP53BP2 Antibody

Sign In for Pricing
View Details
Recombinant TP53BP2 Antibody
RC-15230-03 1 mL

Recombinant TP53BP2 Antibody

Sign In for Pricing
View Details