Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pectobacterium carotovorum subsp. carotovorum ATP synthase subunit c (atpE)

This Recombinant Pectobacterium carotovorum subsp. carotovorum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C6DJG7

Expression Region

1-79

Origin

Pectobacterium carotovorum subsp. carotovorum (strain PC1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLSVDLLYMAAALMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-100 1x 100 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF594 conjugate, 0.1mg/mL
BNC942984-500 1x 500 µL

Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, pan (Cocktail PAN-CK), CF568 conjugate, 0.1mg/mL
BNC680999-500 1x 500 µL

Cytokeratin, pan (Cocktail PAN-CK), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), CF647 conjugate, 0.1mg/mL
BNC472958-100 1x 100 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD147 (8D6), CF740 conjugate, 0.1mg/mL
BNC740424-100 1x 100 µL

CD147 (8D6), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF568 conjugate, 0.1mg/mL
BNC681927-100 1x 100 µL

SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details