Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum ATP synthase subunit c (atpE)

This Recombinant Clostridium botulinum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B1KSS3

Expression Region

1-79

Origin

Clostridium botulinum (strain Loch Maree / Type A3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPKAFVSGMAALGAGIAALACIGAGIGTGNATGKAVEGVSRQPEASGKIMSTLVIGSAF SEATAIYGLIIALFLIFKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse NTF3 ELISA Kit
E061526 1 Each

Mouse NTF3 ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS542160 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
2-Bromobenzothiophene
FAA39413-01 5 g

2-Bromobenzothiophene

Sign In for Pricing
View Details
2-Bromobenzothiophene
FAA39413-02 50 g

2-Bromobenzothiophene

Sign In for Pricing
View Details
Oxtr sgRNA CRISPR Lentivector (Rat) (Target 1)
K6933002 1.0 µg DNA

Oxtr sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Polyclonal Anti- human IFN-gamma Antibody
GWB-BBP003 0.1 mg

Polyclonal Anti- human IFN-gamma Antibody

Sign In for Pricing
View Details