Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum ATP synthase subunit c (atpE)

This Recombinant Clostridium botulinum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B1KSS3

Expression Region

1-79

Origin

Clostridium botulinum (strain Loch Maree / Type A3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPKAFVSGMAALGAGIAALACIGAGIGTGNATGKAVEGVSRQPEASGKIMSTLVIGSAF SEATAIYGLIIALFLIFKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human SYT9 (Synaptotagmin 9 ) for Antibody Discovery
MP0901J Each

Magic™ Membrane Protein Human SYT9 (Synaptotagmin 9 ) for Antibody Discovery

Sign In for Pricing
View Details
ZNF165 Antibody
CSB-PA026551LA01HU-01 50 µg

ZNF165 Antibody

Sign In for Pricing
View Details
ZNF165 Antibody
CSB-PA026551LA01HU-02 100 µg

ZNF165 Antibody

Sign In for Pricing
View Details
Anti-C4d complement
DB-107-0.1 100 μl

Anti-C4d complement

Sign In for Pricing
View Details
VU0519975
HY-179114 1 Each

VU0519975

Sign In for Pricing
View Details
Lentiviral mouse S100a2 shRNA (UAS) - Lentiviral mouse S100a2 shRNA (UAS) (25)
GTR15281489 1 Vial

Lentiviral mouse S100a2 shRNA (UAS) - Lentiviral mouse S100a2 shRNA (UAS) (25)

Sign In for Pricing
View Details