Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype O:3 ATP synthase subunit c (atpE)

This Recombinant Yersinia pseudotuberculosis serotype O:3 ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B1JR36

Expression Region

1-79

Origin

Yersinia pseudotuberculosis serotype O:3 (strain YPIII)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL
BNC401035-500 1x 500 µL

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (HP6054), CF568 conjugate, 0.1mg/mL
BNC680262-100 1x 100 µL

Human Lambda Light Chain (HP6054), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/282), CF568 conjugate, 0.1mg/mL
BNC680282-100 1x 100 µL

HER-2 / CD340 (HRB2/282), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF647 conjugate, 0.1mg/mL
BNC472460-100 1x 100 µL

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF647 conjugate, 0.1mg/mL
BNC471919-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (TGB04 + TGB05), CF647 conjugate, 0.1mg/mL
BNC471227-100 1x 100 µL

Thyroglobulin (TGB04 + TGB05), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details