Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Reactive oxygen species modulator 1 (romo1)

This Recombinant Xenopus laevis Reactive oxygen species modulator 1 (romo1) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

Reactive oxygen species modulator 1, ROS modulator 1, Protein MGR2 homolog

UniProt

Q4V7T9

Expression Region

1-79

Origin

Xenopus laevis (African clawed frog)

Field of Research

Immunology & Inflammation; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVAVGPYGQSQPNCFDRVKMGFMMGFAVGMAAGALFGTFSCLRFGMRGRELMGGVGKTM MQSGGTFGTFMAIGMGIRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), 0.2mg/mL
BNUB2558-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), 0.2mg/mL

Sign In for Pricing
View Details
GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/2362), CF405S conjugate, 0.1mg/mL
BNC042362-500 1x 500 µL

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/2362), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GNG3 Rabbit Polyclonal Antibody
HA500380 100 µL

GNG3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
B3GNT9 (NM_033309) Human Recombinant Protein
TP304295M 100 µg

B3GNT9 (NM_033309) Human Recombinant Protein

Sign In for Pricing
View Details
TdT (DNTT) (NM_001017520) Human Recombinant Protein
TP762363 50 µg

TdT (DNTT) (NM_001017520) Human Recombinant Protein

Sign In for Pricing
View Details
MMP-9 Recombinant Rabbit Monoclonal Antibody [JA80-73]
ET1704-69 100 µL

MMP-9 Recombinant Rabbit Monoclonal Antibody [JA80-73]

Sign In for Pricing
View Details