Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Reactive oxygen species modulator 1 (romo1)

This Recombinant Xenopus laevis Reactive oxygen species modulator 1 (romo1) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

Reactive oxygen species modulator 1, ROS modulator 1, Protein MGR2 homolog

UniProt

Q4V7T9

Expression Region

1-79

Origin

Xenopus laevis (African clawed frog)

Field of Research

Immunology & Inflammation; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVAVGPYGQSQPNCFDRVKMGFMMGFAVGMAAGALFGTFSCLRFGMRGRELMGGVGKTM MQSGGTFGTFMAIGMGIRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCD2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B7]
TA810066AM 100 µL

ABCD2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B7]

Sign In for Pricing
View Details
rac Mono(ethylhexyl) Phthalate
TRC-M542490-25MG 25 mg

rac Mono(ethylhexyl) Phthalate

Sign In for Pricing
View Details
EMPA
TRC-E521550-10MG 10 mg

EMPA

Sign In for Pricing
View Details
2-Mercaptobenzimidazole Zinc Salt
TRC-M252618-5G 5 g

2-Mercaptobenzimidazole Zinc Salt

Sign In for Pricing
View Details
Mammaglobin A (SCGB2A2) (NM_002411) Human Recombinant Protein
TP324550M 100 µg

Mammaglobin A (SCGB2A2) (NM_002411) Human Recombinant Protein

Sign In for Pricing
View Details
Beta Catenin (p120) (Rabbit PAb), CF488A conjugate, 0.1mg/mL
BNC880376-500 1x 500 µL

Beta Catenin (p120) (Rabbit PAb), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details