Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri serotype 5b ATP synthase subunit c (atpE)

This Recombinant Shigella flexneri serotype 5b ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q0SYT9

Expression Region

1-79

Origin

Shigella flexneri serotype 5b (strain 8401)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

M7-5-7593-SL Pre-sized Labels for Printers
312018 100 Box (100 Label (s) x 1 Roll)

M7-5-7593-SL Pre-sized Labels for Printers

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)
MBS2071177-01 0.1 mL

HRP-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)
MBS2071177-02 0.2 mL

HRP-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)
MBS2071177-03 0.5 mL

HRP-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)
MBS2071177-04 1 mL

HRP-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)
MBS2071177-05 5 mL

HRP-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)

Sign In for Pricing
View Details