Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri serotype 5b ATP synthase subunit c (atpE)

This Recombinant Shigella flexneri serotype 5b ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q0SYT9

Expression Region

1-79

Origin

Shigella flexneri serotype 5b (strain 8401)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELP3 Antibody
23-954 100 µL

ELP3 Antibody

Sign In for Pricing
View Details
Stx19 (NM_026588) Mouse Tagged Lenti ORF Clone
MR204000L3 10 µg

Stx19 (NM_026588) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human CTAGE3P Protein
E30P9875 20 µg

Recombinant Human CTAGE3P Protein

Sign In for Pricing
View Details
Rat Tissue Factor Pathway Inhibitor (TFPI) CLIA Kit
abx491438-01 96 Tests

Rat Tissue Factor Pathway Inhibitor (TFPI) CLIA Kit

Sign In for Pricing
View Details
Rat Tissue Factor Pathway Inhibitor (TFPI) CLIA Kit
abx491438-02 5x 96 Tests

Rat Tissue Factor Pathway Inhibitor (TFPI) CLIA Kit

Sign In for Pricing
View Details
Rat Tissue Factor Pathway Inhibitor (TFPI) CLIA Kit
abx491438-03 10x 96 Tests

Rat Tissue Factor Pathway Inhibitor (TFPI) CLIA Kit

Sign In for Pricing
View Details