Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0437 (MJ0437)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0437 (MJ0437) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0437

UniProt

Q57879

Expression Region

1-79

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIHYIVIIMTLLSSLASLLQRDLIKCIILSGFAGLCMAYLYYALLAPDVALTEAILGG AILPALFAFTVRRTQRIDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2',4,4',6,6'-Hexabromo-bibenzyl
TRC-H281405-50MG 50 mg

2,2',4,4',6,6'-Hexabromo-bibenzyl

Sign In for Pricing
View Details
Recombinant Human Transthyretin/TTR Protein (His Tag)
PKSH030907 100 µg

Recombinant Human Transthyretin/TTR Protein (His Tag)

Sign In for Pricing
View Details
HDAC10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H6]
TA500760BM 100 µL

HDAC10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H6]

Sign In for Pricing
View Details
GLI4 (NM_138465) Human Recombinant Protein
TP761499 50 µg

GLI4 (NM_138465) Human Recombinant Protein

Sign In for Pricing
View Details
Vertical Autoclave BAVT-3001
BAVT-3001 1 Unit

Vertical Autoclave BAVT-3001

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 S2 Protein (Fc Tag)
PKSR030491-01 50 µg

Recombinant SARS-CoV-2 S2 Protein (Fc Tag)

Sign In for Pricing
View Details