Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0437 (MJ0437)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0437 (MJ0437) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0437

UniProt

Q57879

Expression Region

1-79

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIHYIVIIMTLLSSLASLLQRDLIKCIILSGFAGLCMAYLYYALLAPDVALTEAILGG AILPALFAFTVRRTQRIDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurofilament (NF-L) (NFL/736), CF740 conjugate, 0.1mg/mL
BNC740736-100 1x 100 µL

Neurofilament (NF-L) (NFL/736), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR561027 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
Human Interleukin-1 Family Member 10 (IL1F10) ELISA Kit
RD-IL1F10-Hu-01 96 Tests

Human Interleukin-1 Family Member 10 (IL1F10) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin-1 Family Member 10 (IL1F10) ELISA Kit
RD-IL1F10-Hu-02 48 Tests

Human Interleukin-1 Family Member 10 (IL1F10) ELISA Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS804098 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Tcaim Mouse Gene Knockout Kit (CRISPR)
KN517299 1 Kit

Tcaim Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details