Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Dolichol phosphate-mannose biosynthesis regulatory protein (dpm2-1)

This Recombinant Dictyostelium discoideum Dolichol phosphate-mannose biosynthesis regulatory protein (dpm2-1) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

Dolichol phosphate-mannose biosynthesis regulatory protein

UniProt

Q556K9

Expression Region

1-79

Origin

Dictyostelium discoideum (Slime mold)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGASDKFIGFVMVLFRIFVFGYYTTWVIITPFIVSDHWIQQYFLPREYGIIIPLVLLVVG ITAIGTFLGLVMIKSKKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Deoxyfructosyl-Val
24013-v 1 mg

1-Deoxyfructosyl-Val

Sign In for Pricing
View Details
Recombinant Human LIM/homeobox protein Lhx1 (C-His)
BP2666-500ug 500 µg

Recombinant Human LIM/homeobox protein Lhx1 (C-His)

Sign In for Pricing
View Details
Dimethyl 2- (5-methyl-2,4-dinitrophenyl) malonate
447129-01 100 mg

Dimethyl 2- (5-methyl-2,4-dinitrophenyl) malonate

Sign In for Pricing
View Details
Dimethyl 2- (5-methyl-2,4-dinitrophenyl) malonate
447129-02 250 mg

Dimethyl 2- (5-methyl-2,4-dinitrophenyl) malonate

Sign In for Pricing
View Details
Recombinant Desulfobacterium autotrophicum Phosphoglucosamine mutase (glmM)
MBS1126138-01 0.02 mg (E-Coli)

Recombinant Desulfobacterium autotrophicum Phosphoglucosamine mutase (glmM)

Sign In for Pricing
View Details
Recombinant Desulfobacterium autotrophicum Phosphoglucosamine mutase (glmM)
MBS1126138-02 0.02 mg (Yeast)

Recombinant Desulfobacterium autotrophicum Phosphoglucosamine mutase (glmM)

Sign In for Pricing
View Details