Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0197 transmembrane protein CBG19073 (CBG19073)

This Recombinant UPF0197 transmembrane protein CBG19073 (CBG19073) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

UPF0197 transmembrane protein CBG19073

UniProt

Q60WL8

Expression Region

1-79

Origin

Caenorhabditis briggsae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDISKMDRYAAPVHFSSLPLLATVLCGVGLLLLAAFTMLQVTSTKYNRNVFKELFIAATS SIFLGFGSVFLLLWVGIYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF647 conjugate, 0.1mg/mL
BNC470164-500 1x 500 µL

CD28 (204.12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL
BNC740218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF647 conjugate, 0.1mg/mL
BNC470176-100 1x 100 µL

CD5 (Cris-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-500 1x 500 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF405S conjugate, 0.1mg/mL
BNC040324-500 1x 500 µL

CD53 (161-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details