Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Protein NEF1 (NEF1)

This Recombinant Chicken Protein NEF1 (NEF1) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

Protein NEF1

UniProt

Q76LT9

Expression Region

1-79

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cystatin-B (CSTB) Porcine ELISA Kit
C7226 96 Tests

Cystatin-B (CSTB) Porcine ELISA Kit

Sign In for Pricing
View Details
PE anti-human CD169 (Sialoadhesin, Siglec-1)
GT12319 25 Tests

PE anti-human CD169 (Sialoadhesin, Siglec-1)

Sign In for Pricing
View Details
Recombinant Human Ig lambda chain V-I region NIG-64
MBS1050366-01 0.02 mg (E-Coli)

Recombinant Human Ig lambda chain V-I region NIG-64

Sign In for Pricing
View Details
Recombinant Human Ig lambda chain V-I region NIG-64
MBS1050366-02 0.1 mg (E-Coli)

Recombinant Human Ig lambda chain V-I region NIG-64

Sign In for Pricing
View Details
Recombinant Human Ig lambda chain V-I region NIG-64
MBS1050366-03 0.02 mg (Yeast)

Recombinant Human Ig lambda chain V-I region NIG-64

Sign In for Pricing
View Details
Recombinant Human Ig lambda chain V-I region NIG-64
MBS1050366-04 0.1 mg (Yeast)

Recombinant Human Ig lambda chain V-I region NIG-64

Sign In for Pricing
View Details