Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Protein NEF1 (NEF1)

This Recombinant Chicken Protein NEF1 (NEF1) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

Protein NEF1

UniProt

Q76LT9

Expression Region

1-79

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD137 (TNFRSF9) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D7]
TA813072AM 100 µL

CD137 (TNFRSF9) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D7]

Sign In for Pricing
View Details
FOXO4 Rabbit Polyclonal Antibody (Cy3)
orb988549 100 µL

FOXO4 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
PF-622
MBS565662-01 5 mg

PF-622

Sign In for Pricing
View Details
PF-622
MBS565662-02 5x 5 mg

PF-622

Sign In for Pricing
View Details
GABPB1 Protein Vector (Mouse) (pPM-C-HA)
21149025 500 ng

GABPB1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
GPR21 Protein Vector (Human) (pPB-N-His)
PV018466 500 ng

GPR21 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details