Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q7VQW1

Expression Region

1-79

Origin

Blochmannia floridanus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNIDMLYIAAAIMMGLSAIGAAVGIGILGSKFLEGAARQPDLVPLLRTQFFIVMGLV DAIPMITVGLSLYVMFAVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Interleukin 17 Receptor A (IL17RA) ELISA Kit-Sandwich
EK10F529-01 48 Test

Canine Interleukin 17 Receptor A (IL17RA) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Canine Interleukin 17 Receptor A (IL17RA) ELISA Kit-Sandwich
EK10F529-02 96 Tests

Canine Interleukin 17 Receptor A (IL17RA) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Hepatitis C Virus, E2 Antigen (HCV)
MBS629691-01 1 mL

Hepatitis C Virus, E2 Antigen (HCV)

Sign In for Pricing
View Details
Hepatitis C Virus, E2 Antigen (HCV)
MBS629691-02 5x 1 mL

Hepatitis C Virus, E2 Antigen (HCV)

Sign In for Pricing
View Details
CD27L CRISPR/Cas9 KO Plasmid (h)
sc-402625 20 µg

CD27L CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Olfr357 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4170908 1.0 µg DNA

Olfr357 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details