Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q7VQW1

Expression Region

1-79

Origin

Blochmannia floridanus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNIDMLYIAAAIMMGLSAIGAAVGIGILGSKFLEGAARQPDLVPLLRTQFFIVMGLV DAIPMITVGLSLYVMFAVV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Albumin protein
MBS537465-01 5 mg

Mouse Albumin protein

Sign In for Pricing
View Details
Mouse Albumin protein
MBS537465-02 5x 5 mg

Mouse Albumin protein

Sign In for Pricing
View Details
MTOR (30)
sc-517464 200 µg/mL

MTOR (30)

Sign In for Pricing
View Details
Proteassemblin (B-1) Alexa Fluor® 488
sc-393267 AF488 200 µg/mL

Proteassemblin (B-1) Alexa Fluor® 488

Sign In for Pricing
View Details
Recombinant Escherichia coli O81 Arginine N-succinyltransferase (astA)
MBS1160099-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O81 Arginine N-succinyltransferase (astA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O81 Arginine N-succinyltransferase (astA)
MBS1160099-02 0.02 mg (Yeast)

Recombinant Escherichia coli O81 Arginine N-succinyltransferase (astA)

Sign In for Pricing
View Details