Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q7VQW1

Expression Region

1-79

Origin

Blochmannia floridanus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNIDMLYIAAAIMMGLSAIGAAVGIGILGSKFLEGAARQPDLVPLLRTQFFIVMGLV DAIPMITVGLSLYVMFAVV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sema4g (NM_011976) Mouse Tagged ORF Clone
MG210903 10 µg

Sema4g (NM_011976) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Anti-TEX37 Antibody
CQA6780-01 30 µL

Anti-TEX37 Antibody

Sign In for Pricing
View Details
Anti-TEX37 Antibody
CQA6780-02 50 μL

Anti-TEX37 Antibody

Sign In for Pricing
View Details
Anti-TEX37 Antibody
CQA6780-03 100 µL

Anti-TEX37 Antibody

Sign In for Pricing
View Details
Anti-TEX37 Antibody
CQA6780-04 200 µL

Anti-TEX37 Antibody

Sign In for Pricing
View Details
Zfp469 Protein Vector (Rat) (pPB-N-His)
PV317867 500 ng

Zfp469 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details