Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae ATP synthase subunit c (atpE)

This Recombinant Buchnera aphidicola subsp. Baizongia pistaciae ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q89B44

Expression Region

1-79

Origin

Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNVSMDMLYIAVAVMIGLAAIGAAVGIGILGSKFLEGVARQPDLTSLLRTQFFVVMGLV DAIPMIAVGLGLYMLFAVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-100 1x 100 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF405S conjugate, 0.1mg/mL
BNC040324-500 1x 500 µL

CD53 (161-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/144B), CF640R conjugate, 0.1mg/mL
BNC400749-500 1x 500 µL

CD8 (C8/144B), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGFalpha (MF9), CF640R conjugate, 0.1mg/mL
BNC400644-100 1x 100 µL

TGFalpha (MF9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (TGB04 + TGB05), CF594 conjugate, 0.1mg/mL
BNC941227-100 1x 100 µL

Thyroglobulin (TGB04 + TGB05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (LK2H10 + PHE5), CF568 conjugate, 0.1mg/mL
BNC680698-100 1x 100 µL

Chromogranin A (LK2H10 + PHE5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details