Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q8D3J8

Expression Region

1-79

Origin

Wigglesworthia glossinidia brevipalpis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSINADLLYISAAIIMGFASIGAAIGIGILGGKFLEGAARQPDLIPTLRTQFFIVMGLV DAIPMISVGLGLYLIFAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BOK Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
13407064 1.0 µg DNA

BOK Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Sodium iodide, 99%
GP2623-250g 250 g

Sodium iodide, 99%

Sign In for Pricing
View Details
Human BMP-7 (Bone Morphogenetic Protein 7) Quick ELISA Kit
orb2568587-01 48 Tests

Human BMP-7 (Bone Morphogenetic Protein 7) Quick ELISA Kit

Sign In for Pricing
View Details
Human BMP-7 (Bone Morphogenetic Protein 7) Quick ELISA Kit
orb2568587-02 96 Tests

Human BMP-7 (Bone Morphogenetic Protein 7) Quick ELISA Kit

Sign In for Pricing
View Details
Recombinant Shigella Flexneri nfo Protein (aa 1-285)
VAng-Lsx07981-500gEcoli 500 µg (E. coli)

Recombinant Shigella Flexneri nfo Protein (aa 1-285)

Sign In for Pricing
View Details
Human E-Cadherin Matched Antibody Pair Set [ABP-S-02487]
ABP-S-02487 5 Plates

Human E-Cadherin Matched Antibody Pair Set [ABP-S-02487]

Sign In for Pricing
View Details