Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Reactive oxygen species modulator 1 (ROMO1)

This Recombinant Human Reactive oxygen species modulator 1 (ROMO1) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

Reactive oxygen species modulator 1, ROS modulator 1, Epididymis tissue protein Li 175, Glyrichin, Mitochondrial targeting GxxxG motif protein, MTGM, Protein MGR2 h

UniProt

P60602

Expression Region

1-79

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTM MQSGGTFGTFMAIGMGIRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBXAS1 Antibody
OAAJ07213-100UL 100 µL

TBXAS1 Antibody

Sign In for Pricing
View Details
FMNL2 sgRNA CRISPR Lentivector (Human) (Target 1)
K0789302 1.0 µg DNA

FMNL2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ROCK2 Antibody
MBS9504523-01 0.05 mL

ROCK2 Antibody

Sign In for Pricing
View Details
ROCK2 Antibody
MBS9504523-02 0.1 mL

ROCK2 Antibody

Sign In for Pricing
View Details
ROCK2 Antibody
MBS9504523-03 5x 0.1 mL

ROCK2 Antibody

Sign In for Pricing
View Details
Heating tape 5/8" x 9'. 80W, 115V
103A FET0.69 1 Each

Heating tape 5/8" x 9'. 80W, 115V

Sign In for Pricing
View Details