Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Reactive oxygen species modulator 1 (ROMO1)

This Recombinant Human Reactive oxygen species modulator 1 (ROMO1) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

Reactive oxygen species modulator 1, ROS modulator 1, Epididymis tissue protein Li 175, Glyrichin, Mitochondrial targeting GxxxG motif protein, MTGM, Protein MGR2 h

UniProt

P60602

Expression Region

1-79

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTM MQSGGTFGTFMAIGMGIRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAPTM5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1196107 1.0 µg DNA

LAPTM5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human DMAC2 (NM_001167870) AAV Particle
RC229605A1V 250 µL

Human DMAC2 (NM_001167870) AAV Particle

Sign In for Pricing
View Details
PTN57491
555830 100.0mg

PTN57491

Sign In for Pricing
View Details
Cyp1b1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3934903 1.0 µg DNA

Cyp1b1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Ethyl 2- (methylthio) acetate
FE35570-01 25 g

Ethyl 2- (methylthio) acetate

Sign In for Pricing
View Details
Ethyl 2- (methylthio) acetate
FE35570-02 50 g

Ethyl 2- (methylthio) acetate

Sign In for Pricing
View Details