Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Reactive oxygen species modulator 1 (ROMO1)

This Recombinant Human Reactive oxygen species modulator 1 (ROMO1) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

Reactive oxygen species modulator 1, ROS modulator 1, Epididymis tissue protein Li 175, Glyrichin, Mitochondrial targeting GxxxG motif protein, MTGM, Protein MGR2 h

UniProt

P60602

Expression Region

1-79

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTM MQSGGTFGTFMAIGMGIRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM50 Human Over-expression Lysate
orb1374695 20 µg

TRIM50 Human Over-expression Lysate

Sign In for Pricing
View Details
WDSUB1 3'UTR Lenti-reporter-Luc Vector
50391081 1.0 µg

WDSUB1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
LDLR Rabbit Polyclonal Antibody (Fluoro550)
orb3120216 100 µg

LDLR Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
β-Actin Double Nickase Plasmid (h)
sc-400000-NIC 20 µg

β-Actin Double Nickase Plasmid (h)

Sign In for Pricing
View Details
MYBBP1A Blocking Peptide
MBS9627525-01 1 mg

MYBBP1A Blocking Peptide

Sign In for Pricing
View Details
MYBBP1A Blocking Peptide
MBS9627525-02 5x 1 mg

MYBBP1A Blocking Peptide

Sign In for Pricing
View Details