Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Reactive oxygen species modulator 1 (ROMO1)

This Recombinant Pig Reactive oxygen species modulator 1 (ROMO1) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

Reactive oxygen species modulator 1, ROS modulator 1, Protein MGR2 homolog

UniProt

A1XQR6

Expression Region

1-79

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Immunology & Inflammation; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGPFSCLRIGMRGRELMGGIGKTM MQSGGTFGPFMAIGMGIRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rrp36 AAV siRNA Pooled Vector
42757164 1.0 µg

Rrp36 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Rabbit Monoclonal SNURPORTIN1 Antibody (SNUPN/7351R) [HRP]
NBP3-20883H 0.1 mL

Rabbit Monoclonal SNURPORTIN1 Antibody (SNUPN/7351R) [HRP]

Sign In for Pricing
View Details
HYAL2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
24109064 1.0 µg DNA

HYAL2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Connective Tissue Growth Factor (CTGF)
MBS2105731-01 0.1 mL

PE-Linked Polyclonal Antibody to Connective Tissue Growth Factor (CTGF)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Connective Tissue Growth Factor (CTGF)
MBS2105731-02 0.2 mL

PE-Linked Polyclonal Antibody to Connective Tissue Growth Factor (CTGF)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Connective Tissue Growth Factor (CTGF)
MBS2105731-03 0.5 mL

PE-Linked Polyclonal Antibody to Connective Tissue Growth Factor (CTGF)

Sign In for Pricing
View Details