Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Reactive oxygen species modulator 1 (ROMO1)

This Recombinant Pig Reactive oxygen species modulator 1 (ROMO1) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

Reactive oxygen species modulator 1, ROS modulator 1, Protein MGR2 homolog

UniProt

A1XQR6

Expression Region

1-79

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Immunology & Inflammation; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGPFSCLRIGMRGRELMGGIGKTM MQSGGTFGPFMAIGMGIRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phlda2 (NM_009434) Mouse Tagged ORF Clone Lentiviral Particle
MR200950L4V 200 µL

Phlda2 (NM_009434) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Ethambutol dihydrochloride
JH914340 1 Each

Ethambutol dihydrochloride

Sign In for Pricing
View Details
GATA1 (Ab-310) Antibody
E11-7093B 100 µg -100 µL

GATA1 (Ab-310) Antibody

Sign In for Pricing
View Details
Recombinant Mouse Nicotinamide riboside kinase 2 (Itgb1bp3)
MBS1482979-01 0.02 mg (E-Coli)

Recombinant Mouse Nicotinamide riboside kinase 2 (Itgb1bp3)

Sign In for Pricing
View Details
Recombinant Mouse Nicotinamide riboside kinase 2 (Itgb1bp3)
MBS1482979-02 0.1 mg (E-Coli)

Recombinant Mouse Nicotinamide riboside kinase 2 (Itgb1bp3)

Sign In for Pricing
View Details
Recombinant Mouse Nicotinamide riboside kinase 2 (Itgb1bp3)
MBS1482979-03 0.02 mg (Yeast)

Recombinant Mouse Nicotinamide riboside kinase 2 (Itgb1bp3)

Sign In for Pricing
View Details