Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P68706

Expression Region

1-79

Origin

Yersinia pestis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLC1 (179-193) Goat Polyclonal Antibody
AP32704PU-N 100 µg

MLC1 (179-193) Goat Polyclonal Antibody

Sign In for Pricing
View Details
DPH4 (DNAJC24) (NM_181706) Human Recombinant Protein
TP309088L 1 mg

DPH4 (DNAJC24) (NM_181706) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue Total RNA, Stomach
CR562367 5 µg

Tissue Total RNA, Stomach

Sign In for Pricing
View Details
CD19 (B-Lymphocyte Marker) (CD19/3116), CF568 conjugate, 0.1mg/mL
BNC683116-100 1x 100 µL

CD19 (B-Lymphocyte Marker) (CD19/3116), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Chchd5 activation kit by CRISPRa
GA206616 1 Kit

Mouse Chchd5 activation kit by CRISPRa

Sign In for Pricing
View Details
Gnrh1 Mouse Gene Knockout Kit (CRISPR)
KN307104RB 1 Kit

Gnrh1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details