Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P68706

Expression Region

1-79

Origin

Yersinia pestis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2683), CF594 conjugate, 0.1mg/mL
BNC942683-500 1x 500 µL

ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2683), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Splicing Factor Proline And Glutamine Rich (SFPQ) ELISA Kit
RDR-SFPQ-Hu-01 96 Tests

Human Splicing Factor Proline And Glutamine Rich (SFPQ) ELISA Kit

Sign In for Pricing
View Details
Human Splicing Factor Proline And Glutamine Rich (SFPQ) ELISA Kit
RDR-SFPQ-Hu-02 48 Tests

Human Splicing Factor Proline And Glutamine Rich (SFPQ) ELISA Kit

Sign In for Pricing
View Details
Disperse Blue 102
TRC-D493480-50MG 50 mg

Disperse Blue 102

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (IGB/3170R), CF647 conjugate, 0.1mg/mL
BNC473170-100 1x 100 µL

CD79b (B-Cell Marker) (IGB/3170R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Deoxy-1-(L-aspartyl)-D-fructose Ammonium Salt
TRC-D232190-10MG 10 mg

1-Deoxy-1-(L-aspartyl)-D-fructose Ammonium Salt

Sign In for Pricing
View Details