Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P68706

Expression Region

1-79

Origin

Yersinia pestis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mannose Receptor (CD206) Recombinant Chimeric Antibody Antibody
HA601452 100 µL

Mannose Receptor (CD206) Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Duodenum
CS505248 5x 5 µm

Frozen Tissue Sections, Duodenum

Sign In for Pricing
View Details
Gamma-Valprolactone
TRC-V094800-250MG 250 mg

Gamma-Valprolactone

Sign In for Pricing
View Details
CD90 / THY1 Recombinant Rabbit Monoclonal Antibody [SU35-07]
ET1608-46 100 µL

CD90 / THY1 Recombinant Rabbit Monoclonal Antibody [SU35-07]

Sign In for Pricing
View Details
beta 3 Adrenergic Receptor (ADRB3) Rabbit Polyclonal Antibody
AP01420PU-N 100 µg

beta 3 Adrenergic Receptor (ADRB3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPL37 Rabbit Polyclonal Antibody
TA381064 100 µL

RPL37 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details