Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P68703

Expression Region

1-79

Origin

Salmonella typhi

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[2,2'-Bipyridine]-6-carbaldehyde
TRC-B592675-50MG 50 mg

[2,2'-Bipyridine]-6-carbaldehyde

Sign In for Pricing
View Details
SCAPER (NM_020843) Human Over-expression Lysate
LC432447 20 µg

SCAPER (NM_020843) Human Over-expression Lysate

Sign In for Pricing
View Details
Collagen III (COL3A1) Rabbit Monoclonal Antibody [Clone ID: R06-4E1]
TA384033 100 µL

Collagen III (COL3A1) Rabbit Monoclonal Antibody [Clone ID: R06-4E1]

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G7]
TA803999AM 100 µL

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G7]

Sign In for Pricing
View Details
Nano Spectrophotometer BSNA-402
BSNA-402 Each

Nano Spectrophotometer BSNA-402

Sign In for Pricing
View Details
Vmn2r61 Mouse Gene Knockout Kit (CRISPR)
KN519192 1 Kit

Vmn2r61 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details