Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P68700

Expression Region

1-79

Origin

Escherichia coli O6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human E3 ubiquitin-protein ligase RING1 Protein
orb1476155-01 50 µg

Human E3 ubiquitin-protein ligase RING1 Protein

Sign In for Pricing
View Details
Human E3 ubiquitin-protein ligase RING1 Protein
orb1476155-02 500 µg

Human E3 ubiquitin-protein ligase RING1 Protein

Sign In for Pricing
View Details
TNF Antibody
KC-065-01 50 μL

TNF Antibody

Sign In for Pricing
View Details
TNF Antibody
KC-065-02 100 µL

TNF Antibody

Sign In for Pricing
View Details
TNF Antibody
KC-065-03 1 mL

TNF Antibody

Sign In for Pricing
View Details
BMP15 (Bone Morphogenetic Protein 15, ODG2, POF4, GDF9B)
308025-01 50 µL

BMP15 (Bone Morphogenetic Protein 15, ODG2, POF4, GDF9B)

Sign In for Pricing
View Details