Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P68705

Expression Region

1-79

Origin

Shigella flexneri

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Schaftoside 10mg
A14654-10 10 mg

Schaftoside 10mg

Sign In for Pricing
View Details
Human Forkhead box protein N3 (FOXN3) ELISA Kit
abx524221 96 Tests

Human Forkhead box protein N3 (FOXN3) ELISA Kit

Sign In for Pricing
View Details
JCHAIN Rabbit Polyclonal Antibody (HRP)
orb474284 100 µL

JCHAIN Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) NRPA1 Polyclonal Antibody
MBS9017133 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) NRPA1 Polyclonal Antibody

Sign In for Pricing
View Details
CCR4 Polyclonal Antibody, HRP Conjugated
bs-20788R-HRP 100 µL

CCR4 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
E coli JM109 Strain Competent Cells 1ml
IECJM109CC1ML 1 mL

E coli JM109 Strain Competent Cells 1ml

Sign In for Pricing
View Details