Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P68705

Expression Region

1-79

Origin

Shigella flexneri

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crotononitrile, mixture of cis and trans
sc-239584 5 mL

Crotononitrile, mixture of cis and trans

Sign In for Pricing
View Details
GW806742X
MBS5753265 Inquire

GW806742X

Sign In for Pricing
View Details
Anti-Alpha 1 microglobulin/Ambp Antibody Picoband®, Dylight550 Conjugate
A02419-4-Dylight550 100 µg

Anti-Alpha 1 microglobulin/Ambp Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Gm9930 3'UTR GFP Stable Cell Line
TU158806 1.0 mL

Gm9930 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human MTOR Knockout HEK293T cell line
GTR15416116 1 Vial

Human MTOR Knockout HEK293T cell line

Sign In for Pricing
View Details
ZNF772 siRNA (Human)
CRJ8091-01 15 nmol

ZNF772 siRNA (Human)

Sign In for Pricing
View Details