Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P68705

Expression Region

1-79

Origin

Shigella flexneri

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCG2 Over-expression Lysate Product
GWB-3937F8 0.1 mg

ABCG2 Over-expression Lysate Product

Sign In for Pricing
View Details
Mouse Monoclonal NFkB p105/p50 Antibody (2J10D7) [Alexa Fluor 532]
NB100-56583AF532 0.1 mL

Mouse Monoclonal NFkB p105/p50 Antibody (2J10D7) [Alexa Fluor 532]

Sign In for Pricing
View Details
Lentiviral human PSMA1 shRNA (UAS) - Lentiviral human PSMA1 shRNA (UAS, iRFP) plasmid
GTR15135076 1 Vial

Lentiviral human PSMA1 shRNA (UAS) - Lentiviral human PSMA1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Anti-CCR3 Antibody
CQA6591-01 30 µL

Anti-CCR3 Antibody

Sign In for Pricing
View Details
Anti-CCR3 Antibody
CQA6591-02 50 μL

Anti-CCR3 Antibody

Sign In for Pricing
View Details
Anti-CCR3 Antibody
CQA6591-03 100 µL

Anti-CCR3 Antibody

Sign In for Pricing
View Details