Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Reactive oxygen species modulator 1 (romo1)

This Recombinant Danio rerio Reactive oxygen species modulator 1 (romo1) spans the amino acid sequence from region 1-80.

Product Specifications

Product Name Alternative

Reactive oxygen species modulator 1, ROS modulator 1, Protein MGR2 homolog

UniProt

Q6NYD1

Expression Region

1-80

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Immunology & Inflammation; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVSVGSYGQQAQPSCFDRVKMGFMMGFAVGMAAGAMFGTFSCLRIGMRGRELMGGVGKT MMQSGGTFGTFMAIGMGIRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJB13, ID (DNAJB13, TSARG3, TSARG6, DnaJ homolog subfamily B member 13, Testis and spermatogenesis cell-related protein 6, Testis spermatocyte apoptosis-related gene 6 protein, Testis spermatogenesis apoptosis-related gene 3 protein, Testis spermatogenesis apoptosis-related gene 6 protein) (APC) discontinued
034700-APC 200 µL

DNAJB13, ID (DNAJB13, TSARG3, TSARG6, DnaJ homolog subfamily B member 13, Testis and spermatogenesis cell-related protein 6, Testis spermatocyte apoptosis-related gene 6 protein, Testis spermatogenesis apoptosis-related gene 3 protein, Testis spermatogenesis apoptosis-related gene 6 protein) (APC) discontinued

Sign In for Pricing
View Details
DOTAP chloride
C12308 25 mg

DOTAP chloride

Sign In for Pricing
View Details
TLE4 (NM_001282748) Human Tagged ORF Clone
RG239600 10 µg

TLE4 (NM_001282748) Human Tagged ORF Clone

Sign In for Pricing
View Details
pOTB7-ITFG2 Plasmid
PVT25401 2 µg

pOTB7-ITFG2 Plasmid

Sign In for Pricing
View Details
IL-17A : IL-17RA [Biotinylated] Inhibitor Screening ELISA Kit
EP-140-96tests 96 Tests

IL-17A : IL-17RA [Biotinylated] Inhibitor Screening ELISA Kit

Sign In for Pricing
View Details
CRABP1
ant-363 5µg

CRABP1

Sign In for Pricing
View Details