Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Reactive oxygen species modulator 1 (romo1)

This Recombinant Danio rerio Reactive oxygen species modulator 1 (romo1) spans the amino acid sequence from region 1-80.

Product Specifications

Product Name Alternative

Reactive oxygen species modulator 1, ROS modulator 1, Protein MGR2 homolog

UniProt

Q6NYD1

Expression Region

1-80

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Immunology & Inflammation; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVSVGSYGQQAQPSCFDRVKMGFMMGFAVGMAAGAMFGTFSCLRIGMRGRELMGGVGKT MMQSGGTFGTFMAIGMGIRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kcnd1 Rabbit Polyclonal Antibody (FITC)
orb2133853 100 µL

Kcnd1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Carbonic anhydrase 1 (CA1)
309057-01 50 µL

Carbonic anhydrase 1 (CA1)

Sign In for Pricing
View Details
Carbonic anhydrase 1 (CA1)
309057-02 100 µL

Carbonic anhydrase 1 (CA1)

Sign In for Pricing
View Details
TRIM61 (NM_001012414) Human Over-expression Lysate
LS391712-100ug 100 µg

TRIM61 (NM_001012414) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Mouse DIXDC1 Polyclonal Antibody
MS943014-01 50 µg

Anti-Mouse DIXDC1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse DIXDC1 Polyclonal Antibody
MS943014-02 100 µg

Anti-Mouse DIXDC1 Polyclonal Antibody

Sign In for Pricing
View Details