Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Reactive oxygen species modulator 1 (romo1)

This Recombinant Danio rerio Reactive oxygen species modulator 1 (romo1) spans the amino acid sequence from region 1-80.

Product Specifications

Product Name Alternative

Reactive oxygen species modulator 1, ROS modulator 1, Protein MGR2 homolog

UniProt

Q6NYD1

Expression Region

1-80

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Immunology & Inflammation; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVSVGSYGQQAQPSCFDRVKMGFMMGFAVGMAAGAMFGTFSCLRIGMRGRELMGGVGKT MMQSGGTFGTFMAIGMGIRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pth1r (NM_011199) Mouse Tagged ORF Clone Lentiviral Particle
MR226546L3V 200 µL

Pth1r (NM_011199) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
S (+) -2-Amino-1-Butanol (D-2-Aminobutanol)
006550-01 1 g

S (+) -2-Amino-1-Butanol (D-2-Aminobutanol)

Sign In for Pricing
View Details
S (+) -2-Amino-1-Butanol (D-2-Aminobutanol)
006550-02 5 g

S (+) -2-Amino-1-Butanol (D-2-Aminobutanol)

Sign In for Pricing
View Details
Zmat3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
51268114 3x 1.0 µg

Zmat3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse RHOB siRNA
abx931465-01 15 nmol

Mouse RHOB siRNA

Sign In for Pricing
View Details
Mouse RHOB siRNA
abx931465-02 30 nmol

Mouse RHOB siRNA

Sign In for Pricing
View Details