Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Adipogenin (Adig)

This Recombinant Mouse Adipogenin (Adig) spans the amino acid sequence from region 1-80.

Product Specifications

Product Name Alternative

Adipogenin, Small adipocyte factor 1, SMAF-1

UniProt

Q8R400

Expression Region

1-80

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYPLVPLVSDLTLSFLVFWLCLPVALLLFLTIVWLHFLLSQESKEDDSDLCFNWEPWSK RPSECGCEETFPGEEDGLHW

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS24P7-set siRNA/shRNA/RNAi Lentivector (Human)
42279091 4x 500 ng

RPS24P7-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Bak Recombinant Rabbit mAb, IRDye 800CW conjugated
orb3125292 100 µL

Bak Recombinant Rabbit mAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
HPX ELISA Kit (Mouse) (OKAN04989)
OKAN04989 96 Well

HPX ELISA Kit (Mouse) (OKAN04989)

Sign In for Pricing
View Details
Rabbit Anti-Beta catenin, Alexa Fluor 680 conjugated antibody
SL23663R-AF680-01 Inquire

Rabbit Anti-Beta catenin, Alexa Fluor 680 conjugated antibody

Sign In for Pricing
View Details
Rabbit Anti-Beta catenin, Alexa Fluor 680 conjugated antibody
SL23663R-AF680-02 100 µL

Rabbit Anti-Beta catenin, Alexa Fluor 680 conjugated antibody

Sign In for Pricing
View Details
Apolipoprotein A5 Rabbit Polyclonal Antibody
orb382528-01 30 µL

Apolipoprotein A5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details