Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Adipogenin (Adig)

This Recombinant Mouse Adipogenin (Adig) spans the amino acid sequence from region 1-80.

Product Specifications

Product Name Alternative

Adipogenin, Small adipocyte factor 1, SMAF-1

UniProt

Q8R400

Expression Region

1-80

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYPLVPLVSDLTLSFLVFWLCLPVALLLFLTIVWLHFLLSQESKEDDSDLCFNWEPWSK RPSECGCEETFPGEEDGLHW

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synaptotagmin 1 (SYT1) Human shRNA Lentiviral Particle (Locus ID 6857)
TL308980V 500 µL Each

Synaptotagmin 1 (SYT1) Human shRNA Lentiviral Particle (Locus ID 6857)

Sign In for Pricing
View Details
BAT5 Antibody - middle region : HRP (ARP49633_P050-HRP)
ARP49633_P050-HRP 100 µL

BAT5 Antibody - middle region : HRP (ARP49633_P050-HRP)

Sign In for Pricing
View Details
NM23A (NME1) Mouse Monoclonal Antibody [Clone ID: OTI1C11]
TA801394S 30 µL

NM23A (NME1) Mouse Monoclonal Antibody [Clone ID: OTI1C11]

Sign In for Pricing
View Details
Recombinant Human Fractalkine (CX3CL1) His Tag
7-01850 10 µg

Recombinant Human Fractalkine (CX3CL1) His Tag

Sign In for Pricing
View Details
(4-Aminooxepan-4-yl) methanol hydrochloride
PZC01393-01 50 mg

(4-Aminooxepan-4-yl) methanol hydrochloride

Sign In for Pricing
View Details
(4-Aminooxepan-4-yl) methanol hydrochloride
PZC01393-02 0.5 g

(4-Aminooxepan-4-yl) methanol hydrochloride

Sign In for Pricing
View Details