Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adipogenin (ADIG)

This Recombinant Human Adipogenin (ADIG) spans the amino acid sequence from region 1-80.

Product Specifications

Product Name Alternative

Adipogenin

UniProt

Q0VDE8

Expression Region

1-80

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYPLMPLVNDLTFSFLVFWFCLPVGLLLLLIIWLRFLLSQDSEENDSSVCLDWEPWSKG PAEFCWKGTLHGQEKERPCW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-p107 Antibody
MBS8222101-01 0.03 mL

Anti-p107 Antibody

Sign In for Pricing
View Details
Anti-p107 Antibody
MBS8222101-02 0.05 mL

Anti-p107 Antibody

Sign In for Pricing
View Details
Anti-p107 Antibody
MBS8222101-03 0.1 mL

Anti-p107 Antibody

Sign In for Pricing
View Details
Anti-p107 Antibody
MBS8222101-04 0.2 mL

Anti-p107 Antibody

Sign In for Pricing
View Details
Anti-p107 Antibody
MBS8222101-05 5x 0.2 mL

Anti-p107 Antibody

Sign In for Pricing
View Details
Klk1b3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6782206 1.0 µg DNA

Klk1b3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details