Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Serine palmitoyltransferase small subunit B (sptssb)

This Recombinant Danio rerio Serine palmitoyltransferase small subunit B (sptssb) spans the amino acid sequence from region 1-80.

Product Specifications

Product Name Alternative

Serine palmitoyltransferase small subunit B, Protein ADMP, Small subunit of serine palmitoyltransferase B, ssSPTb

UniProt

Q1RLT2

Expression Region

1-80

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDMKNMREYMSWLYYQYLLITGIYVLEPWEQSIFNTVLFTMVAMVIYTSYVFVPIHVRLA LEFFCELVGGQPESTVALMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-100 1x 100 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
BNC470676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-500 1x 500 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
BNC470965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/1030), CF568 conjugate, 0.1mg/mL
BNC681030-500 1x 500 µL

CD66 (CEA) (C66/1030), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (ID8), CF647 conjugate, 0.1mg/mL
BNC470920-100 1x 100 µL

Myosin, Smooth Muscle Heavy Chain (ID8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details