Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Serine palmitoyltransferase small subunit A-B (sptssa-b)

This Recombinant Xenopus laevis Serine palmitoyltransferase small subunit A-B (sptssa-b) spans the amino acid sequence from region 1-80.

Product Specifications

Product Name Alternative

Serine palmitoyltransferase small subunit A-B, Small subunit of serine palmitoyltransferase A-B, ssSPTa-B

UniProt

Q6GPZ5

Expression Region

1-80

Origin

Xenopus laevis (African clawed frog)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKVSCEDVNGPRSSLGRAWNHVSWLYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYT GYIFMPQHILAILHYFEIVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF647 conjugate, 0.1mg/mL
BNC470333-500 1x 500 µL

CD8 (RIV11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-500 1x 500 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
BNC042853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
BNC880009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF568 conjugate, 0.1mg/mL
BNC680324-500 1x 500 µL

CD53 (161-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF647 conjugate, 0.1mg/mL
BNC470338-500 1x 500 µL

P53 (PAb122), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details