Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse FXYD domain-containing ion transport regulator 7 (Fxyd7)

This Recombinant Mouse FXYD domain-containing ion transport regulator 7 (Fxyd7) spans the amino acid sequence from region 1-80.

Product Specifications

Product Name Alternative

FXYD domain-containing ion transport regulator 7

UniProt

P59648

Expression Region

1-80

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATPTQSPTNVPEETDPFFYDYATVQTVGMTLATIMFVLGIIIILSKKVKCRKADSRSES PTCKSCKSELPSSAPGGGGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZDHHC17 (NM_015336) Human Over-expression Lysate
LY402425 100 µg

ZDHHC17 (NM_015336) Human Over-expression Lysate

Sign In for Pricing
View Details
Piracetam-d8
TRC-P500802-1MG 1 mg

Piracetam-d8

Sign In for Pricing
View Details
Human ZC3H12B activation kit by CRISPRa
GA117490 1 Kit

Human ZC3H12B activation kit by CRISPRa

Sign In for Pricing
View Details
(±)-alpha-Lipoamide
TRC-L468710-1G 1 g

(±)-alpha-Lipoamide

Sign In for Pricing
View Details
Flupyrimin
TRC-F168955-10MG 10 mg

Flupyrimin

Sign In for Pricing
View Details
Mrap (NM_029844) Mouse Tagged ORF Clone
MG200684 10 µg

Mrap (NM_029844) Mouse Tagged ORF Clone

Sign In for Pricing
View Details