Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Scheffersomyces stipitis Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21)

This Recombinant Scheffersomyces stipitis Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21) spans the amino acid sequence from region 1-80.

Product Specifications

Product Name Alternative

Vacuolar ATPase assembly integral membrane protein VMA21

UniProt

A3LU53

Expression Region

1-80

Origin

Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAEIPTSVIQKLVFFTGAMIIFPIFTFFVCQYLFSNNALISGGIAALMANVVLIGYVVV AFTEDTSSLADEKVETKKDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INSM1 (m) -PR
sc-72310-PR 10 µM - 20 µL

INSM1 (m) -PR

Sign In for Pricing
View Details
AP1M2 Antibody
A71922-50UL 50 μL

AP1M2 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal NrCAM Antibody (MM0495-8E25) [DyLight 488]
NBP2-11826G 0.1 mL

Mouse Monoclonal NrCAM Antibody (MM0495-8E25) [DyLight 488]

Sign In for Pricing
View Details
MEI1 Protein Vector (Rat) (pPB-C-His)
PV281802 500 ng

MEI1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
ITGA6 Antibody
orb675955-01 50 µg

ITGA6 Antibody

Sign In for Pricing
View Details
ITGA6 Antibody
orb675955-02 100 µg

ITGA6 Antibody

Sign In for Pricing
View Details