Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein yfdY (yfdY)

This Recombinant Escherichia coli Uncharacterized protein yfdY (yfdY) spans the amino acid sequence from region 1-80.

Product Specifications

Product Name Alternative

Uncharacterized protein yfdY

UniProt

P76521

Expression Region

1-80

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINLWMFLALCIVCVSGYIGQVLNVVSAVSSFFGMVILAALIYYFTMWLTGGNELVTGIF MFLAPACGLMIRFMVGYGRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRK5 (NM_005308) Human Over-expression Lysate
LY401636 100 µg

GRK5 (NM_005308) Human Over-expression Lysate

Sign In for Pricing
View Details
Uncoated Mouse TF (Tissue factor) ELISA Kit
E-UNEL-M0155-01 5x 96 Tests

Uncoated Mouse TF (Tissue factor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse TF (Tissue factor) ELISA Kit
E-UNEL-M0155-02 15x 96 Tests

Uncoated Mouse TF (Tissue factor) ELISA Kit

Sign In for Pricing
View Details
Osteopontin Recombinant Rabbit monoclonal Antibody
HA751506 100 µL

Osteopontin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human GPCR MRGX2 (MRGPRX2) activation kit by CRISPRa
GA114635 1 Kit

Human GPCR MRGX2 (MRGPRX2) activation kit by CRISPRa

Sign In for Pricing
View Details
MALT-1 (MT1/410), CF488A conjugate, 0.1mg/mL
BNC880410-100 1x 100 µL

MALT-1 (MT1/410), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details