Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein yfdY (yfdY)

This Recombinant Escherichia coli Uncharacterized protein yfdY (yfdY) spans the amino acid sequence from region 1-80.

Product Specifications

Product Name Alternative

Uncharacterized protein yfdY

UniProt

P76521

Expression Region

1-80

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINLWMFLALCIVCVSGYIGQVLNVVSAVSSFFGMVILAALIYYFTMWLTGGNELVTGIF MFLAPACGLMIRFMVGYGRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Serum Albumin Antibody
RC-16416-01 50 μL

Recombinant Serum Albumin Antibody

Sign In for Pricing
View Details
Recombinant Serum Albumin Antibody
RC-16416-02 100 µL

Recombinant Serum Albumin Antibody

Sign In for Pricing
View Details
Recombinant Serum Albumin Antibody
RC-16416-03 1 mL

Recombinant Serum Albumin Antibody

Sign In for Pricing
View Details
FARSLB (FARSB) Mouse Monoclonal Antibody [Clone ID: 2F11]
AM20977PU-N 50 µg

FARSLB (FARSB) Mouse Monoclonal Antibody [Clone ID: 2F11]

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2445), CF594 conjugate, 0.1mg/mL
BNC942445-100 1x 100 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2445), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PRKAR1B Polyclonal Antibody
E-AB-90082-01 60 µL

PRKAR1B Polyclonal Antibody

Sign In for Pricing
View Details