Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anthoceros formosae ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Anthoceros formosae ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P61172

Expression Region

1-81

Origin

Anthoceros formosae (Hornwort)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/3219R), CF594 conjugate, 0.1mg/mL
BNC943219-500 1x 500 µL

Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/3219R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2,2,5,5-Tetramethyl-3-pyrrolidinecarboxamide
T2978-33 500 mg

2,2,5,5-Tetramethyl-3-pyrrolidinecarboxamide

Sign In for Pricing
View Details
Recombinant Human DNAJC16, His-tagged
DNAJC16-12077H 25 µg

Recombinant Human DNAJC16, His-tagged

Sign In for Pricing
View Details
Olr1280 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV632841 1.0 µg DNA

Olr1280 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
CNN1, Recombinant, Human, His-Tag discontinued
590865-01 20 µg

CNN1, Recombinant, Human, His-Tag discontinued

Sign In for Pricing
View Details
CNN1, Recombinant, Human, His-Tag discontinued
590865-02 100 µg

CNN1, Recombinant, Human, His-Tag discontinued

Sign In for Pricing
View Details