Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P63691

Expression Region

1-81

Origin

Mycobacterium tuberculosis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLV EAAYFINLAFMALFVFATPVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOLPH2 (GOLM1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B3]
TA504114AM 100 µL

GOLPH2 (GOLM1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B3]

Sign In for Pricing
View Details
Ssr2 Mouse Gene Knockout Kit (CRISPR)
KN516769 1 Kit

Ssr2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MPC1L Human Gene Knockout Kit (CRISPR)
KN430973 1 Kit

MPC1L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ZNF71 activation kit by CRISPRa
GA111774 1 Kit

Human ZNF71 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) activation kit by CRISPRa
GA109602 1 Kit

Human Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) activation kit by CRISPRa

Sign In for Pricing
View Details
(2R,3R)-2-Bromo-3-hydroxybutanedioic Acid 1,4-Diethyl Ester
TRC-B687560-5G 5 g

(2R,3R)-2-Bromo-3-hydroxybutanedioic Acid 1,4-Diethyl Ester

Sign In for Pricing
View Details