Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P63691

Expression Region

1-81

Origin

Mycobacterium tuberculosis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLV EAAYFINLAFMALFVFATPVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coiled-coil domain-containing protein 80 (CCDC80) Human ELISA Kit
C4564 96 Tests

Coiled-coil domain-containing protein 80 (CCDC80) Human ELISA Kit

Sign In for Pricing
View Details
Human Aromatase,ARO ELISA KIT
JOT-EK3348Hu-01 48 Well

Human Aromatase,ARO ELISA KIT

Sign In for Pricing
View Details
Human Aromatase,ARO ELISA KIT
JOT-EK3348Hu-02 96 Well

Human Aromatase,ARO ELISA KIT

Sign In for Pricing
View Details
BCL7B Antibody Blocking peptide
orb1454072 500 µg

BCL7B Antibody Blocking peptide

Sign In for Pricing
View Details
Hoxb6, NT (Hoxb6, Hox-2.2, Hoxb-6, Homeobox protein Hox-B6, Homeobox protein Hox-2.2, Homeobox protein MH-22A) (Biotin)
MBS6307871-01 0.2 mL

Hoxb6, NT (Hoxb6, Hox-2.2, Hoxb-6, Homeobox protein Hox-B6, Homeobox protein Hox-2.2, Homeobox protein MH-22A) (Biotin)

Sign In for Pricing
View Details
Hoxb6, NT (Hoxb6, Hox-2.2, Hoxb-6, Homeobox protein Hox-B6, Homeobox protein Hox-2.2, Homeobox protein MH-22A) (Biotin)
MBS6307871-02 5x 0.2 mL

Hoxb6, NT (Hoxb6, Hox-2.2, Hoxb-6, Homeobox protein Hox-B6, Homeobox protein Hox-2.2, Homeobox protein MH-22A) (Biotin)

Sign In for Pricing
View Details