Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P63691

Expression Region

1-81

Origin

Mycobacterium tuberculosis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLV EAAYFINLAFMALFVFATPVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-AKR7A2
Y058468 100 µL

Anti-AKR7A2

Sign In for Pricing
View Details
HypoGel® 200 Diol
SP20011015010.100G 100 g

HypoGel® 200 Diol

Sign In for Pricing
View Details
Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF740 conjugate, 0.1mg/mL
BNC740183-500 1x 500 µL

Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (rPAX5/2060), CF405S conjugate, 0.1mg/mL
BNC042301-500 1x 500 µL

PAX5 / BSAP (Early B-Cell Marker) (rPAX5/2060), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Purified Anti-Human CD18 Antibody[TS1/18.1.2.11]
E-AB-F1057A-01 25 µg

Purified Anti-Human CD18 Antibody[TS1/18.1.2.11]

Sign In for Pricing
View Details
Purified Anti-Human CD18 Antibody[TS1/18.1.2.11]
E-AB-F1057A-02 100 µg

Purified Anti-Human CD18 Antibody[TS1/18.1.2.11]

Sign In for Pricing
View Details