Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Marchantia polymorpha ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P62481

Expression Region

1-81

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Varicella Zoster Virus, IE62 (VZV)
MBS607760-01 0.5 mg

Varicella Zoster Virus, IE62 (VZV)

Sign In for Pricing
View Details
Varicella Zoster Virus, IE62 (VZV)
MBS607760-02 5x 0.5 mg

Varicella Zoster Virus, IE62 (VZV)

Sign In for Pricing
View Details
Phospho-Glycogen synthase 1 (Ser641) Rabbit pAb, BF700 conjugated
orb2841123 100 µL

Phospho-Glycogen synthase 1 (Ser641) Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal Rabbit anti-Mouse IgM Secondary Antibody [Allophycocyanin/Cy7]
NBP1-72789APCCY7 0.5 mL

Rabbit Polyclonal Rabbit anti-Mouse IgM Secondary Antibody [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
MitoPQ
E1252-25mg 25 mg

MitoPQ

Sign In for Pricing
View Details
Taq DNA Polymerase
STDP42-5K 5000 Units

Taq DNA Polymerase

Sign In for Pricing
View Details